Lineage for d1aiph1 (1aip H:3-53)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 352395Fold a.5: RuvA C-terminal domain-like [46928] (6 superfamilies)
    3 helices; bundle, right-handed twist
  4. 352419Superfamily a.5.2: UBA-like [46934] (4 families) (S)
  5. 352436Family a.5.2.2: TS-N domain [63423] (1 protein)
  6. 352437Protein Elongation factor Ts (EF-Ts), N-terminal domain [63424] (2 species)
  7. 352441Species Thermus thermophilus [TaxId:274] [63426] (1 PDB entry)
  8. 352445Domain d1aiph1: 1aip H:3-53 [58936]
    Other proteins in same PDB: d1aipa1, d1aipa2, d1aipa3, d1aipb1, d1aipb2, d1aipb3, d1aipc2, d1aipd2, d1aipe1, d1aipe2, d1aipe3, d1aipf1, d1aipf2, d1aipf3, d1aipg2, d1aiph2

Details for d1aiph1

PDB Entry: 1aip (more details), 3 Å

PDB Description: ef-tu ef-ts complex from thermus thermophilus

SCOP Domain Sequences for d1aiph1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aiph1 a.5.2.2 (H:3-53) Elongation factor Ts (EF-Ts), N-terminal domain {Thermus thermophilus}
qmelikklreatgagmmdvkraledagwdeekavqllrergamkaakkadr

SCOP Domain Coordinates for d1aiph1:

Click to download the PDB-style file with coordinates for d1aiph1.
(The format of our PDB-style files is described here.)

Timeline for d1aiph1: