| Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
| Fold d.43: EF-Ts domain-like [54712] (2 superfamilies) beta(2)-alpha(n)-beta; 2 layers a/b; antiparallel sheet: 123 |
Superfamily d.43.1: Elongation factor Ts (EF-Ts), dimerisation domain [54713] (1 family) ![]() comprises two structural repeats of this fold |
| Family d.43.1.1: Elongation factor Ts (EF-Ts), dimerisation domain [54714] (1 protein) |
| Protein Elongation factor Ts (EF-Ts), dimerisation domain [63422] (3 species) |
| Species Thermus thermophilus [TaxId:274] [54717] (2 PDB entries) |
| Domain d1aipg2: 1aip G:54-196 [58935] Other proteins in same PDB: d1aipa1, d1aipa2, d1aipa3, d1aipb1, d1aipb2, d1aipb3, d1aipc1, d1aipd1, d1aipe1, d1aipe2, d1aipe3, d1aipf1, d1aipf2, d1aipf3, d1aipg1, d1aiph1 |
PDB Entry: 1aip (more details), 3 Å
SCOP Domain Sequences for d1aipg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aipg2 d.43.1.1 (G:54-196) Elongation factor Ts (EF-Ts), dimerisation domain {Thermus thermophilus}
earegiighyihhnqrvgvlvelncetdfvarnelfqnlakdlamhiammnpryvsaeei
paeelekerqiyiqaalnegkpqqiaekiaegrlkkyleevvlleqpfvkddkvkvkeli
qqaiakigenivvrrfcrfelga
Timeline for d1aipg2: