SCOP 1.59: Domain d1aipg2: 1aip G:54-196

Lineage for d1aipg2 (1aip G:54-196)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.43: Elongation factor Ts (EF-Ts), dimerisation domain [54712] (1 superfamily)

4. Superfamily d.43.1: Elongation factor Ts (EF-Ts), dimerisation domain [54713] (1 family)

5. Family d.43.1.1: Elongation factor Ts (EF-Ts), dimerisation domain [54714] (1 protein)

6. Protein Elongation factor Ts (EF-Ts), dimerisation domain [63422] (2 species)

7. Species Thermus thermophilus [TaxId:274] [54717] (2 PDB entries)

8. Domain d1aipg2: 1aip G:54-196 [58935]
   Other proteins in same PDB: d1aipa1, d1aipa2, d1aipa3, d1aipb1, d1aipb2, d1aipb3, d1aipc1, d1aipd1, d1aipe1, d1aipe2, d1aipe3, d1aipf1, d1aipf2, d1aipf3, d1aipg1, d1aiph1

Details for d1aipg2

PDB Entry: 1aip, 3 Å

PDB Description: ef-tu ef-ts complex from thermus thermophilus

SCOP Domain Sequences for d1aipg2:

Sequence; same for both SEQRES and ATOM records:

>d1aipg2 d.43.1.1 (G:54-196) Elongation factor Ts (EF-Ts), dimerisation domain {Thermus thermophilus}
earegiighyihhnqrvgvlvelncetdfvarnelfqnlakdlamhiammnpryvsaeei
paeelekerqiyiqaalnegkpqqiaekiaegrlkkyleevvlleqpfvkddkvkvkeli
qqaiakigenivvrrfcrfelga

Timeline for d1aipg2:

• d1aipg2 first appeared in SCOP 1.57
  
• d1aipg2 appears in SCOP 1.61
  
• d1aipg2 appears in the current release, SCOPe 2.08