Lineage for d1zdaa_ (1zda A:)
- Root: SCOPe 2.06
Class k: Designed proteins [58788] (44 folds) 
Fold k.13: Protein A Ig(Fc)-binding domain mimics [58863] (1 superfamily) Superfamily k.13.1: Protein A Ig(Fc)-binding domain mimics [58864] (1 family) 
Family k.13.1.1: Protein A Ig(Fc)-binding domain mimics [58865] (1 protein) Protein Protein A Ig(Fc)-binding domain mimics [58866] (2 species) Species Synthetic [58867] (7 PDB entries) 
Domain d1zdaa_: 1zda A: [46437]
phage-selected minidomain
Details for d1zdaa_
PDB Entry: 1zda (more details)
PDB Description: phage-selected mini protein a domain, z38, nmr, 24 structures
PDB Compounds: (A:) mini protein a domain, z38SCOPe Domain Sequences for d1zdaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zdaa_ k.13.1.1 (A:) Protein A Ig(Fc)-binding domain mimics {Synthetic}
avaqsfnmqqqrrfyealhdpnlneeqrnakiksirdd
SCOPe Domain Coordinates for d1zdaa_:
Click to download the PDB-style file with coordinates for d1zdaa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1zdaa_:
- d1zdaa_ first appeared (with stable ids) in SCOP 1.55, called d1zda__
- d1zdaa_ appears in SCOPe 2.05
- d1zdaa_ appears in the current release, SCOPe 2.07
View in 3D