Lineage for d1zdda_ (1zdd A:)

  1. Root: SCOPe 2.06
  2. 2273425Class k: Designed proteins [58788] (44 folds)
  3. 2273682Fold k.13: Protein A Ig(Fc)-binding domain mimics [58863] (1 superfamily)
  4. 2273683Superfamily k.13.1: Protein A Ig(Fc)-binding domain mimics [58864] (1 family) (S)
  5. 2273684Family k.13.1.1: Protein A Ig(Fc)-binding domain mimics [58865] (1 protein)
  6. 2273685Protein Protein A Ig(Fc)-binding domain mimics [58866] (2 species)
  7. 2273689Species Synthetic [58867] (7 PDB entries)
  8. 2273695Domain d1zdda_: 1zdd A: [46435]
    disulfide-stabilized minidomain

Details for d1zdda_

PDB Entry: 1zdd (more details)

PDB Description: disulfide-stabilized mini protein a domain, z34c, nmr, minimized mean structure
PDB Compounds: (A:) stable mini protein a domain, z34c

SCOPe Domain Sequences for d1zdda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zdda_ k.13.1.1 (A:) Protein A Ig(Fc)-binding domain mimics {Synthetic}
fnmqcqrrfyealhdpnlneeqrnakiksirddc

SCOPe Domain Coordinates for d1zdda_:

Click to download the PDB-style file with coordinates for d1zdda_.
(The format of our PDB-style files is described here.)

Timeline for d1zdda_: