Lineage for d1f3ma_ (1f3m A:)

  1. Root: SCOP 1.71
  2. 629440Class j: Peptides [58231] (116 folds)
  3. 630627Fold j.66: pak1 autoregulatory domain [58728] (1 superfamily)
  4. 630628Superfamily j.66.1: pak1 autoregulatory domain [58729] (1 family) (S)
  5. 630629Family j.66.1.1: pak1 autoregulatory domain [58730] (1 protein)
  6. 630630Protein pak1 autoregulatory domain [58731] (1 species)
  7. 630631Species Human (Homo sapiens) [TaxId:9606] [58732] (1 PDB entry)
  8. 630632Domain d1f3ma_: 1f3m A: [46358]
    Other proteins in same PDB: d1f3mc_, d1f3md_

Details for d1f3ma_

PDB Entry: 1f3m (more details), 2.3 Å

PDB Description: crystal structure of human serine/threonine kinase pak1

SCOP Domain Sequences for d1f3ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3ma_ j.66.1.1 (A:) pak1 autoregulatory domain {Human (Homo sapiens)}
psdfehtihvgfdavtgeftgmpeqwarllqtsnitkseqkknpqavldvlefynskkts
nsqkymsftd

SCOP Domain Coordinates for d1f3ma_:

Click to download the PDB-style file with coordinates for d1f3ma_.
(The format of our PDB-style files is described here.)

Timeline for d1f3ma_: