SCOP 1.71: Domain d1eesb_: 1ees B:

Lineage for d1eesb_ (1ees B:)

1. Root: SCOP 1.71

2. Class j: Peptides [58231] (116 folds)

3. Fold j.65: Peptide derived from p-21 activated kinase [58722] (1 superfamily)

4. Superfamily j.65.1: Peptide derived from p-21 activated kinase [58723] (1 family)

5. Family j.65.1.1: Peptide derived from p-21 activated kinase [58724] (1 protein)

6. Protein Peptide derived from p-21 activated kinase [58725] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [58726] (1 PDB entry)

8. Domain d1eesb_: 1ees B: [46356]
   Other proteins in same PDB: d1eesa_
   bound to CDC42Hs

Details for d1eesb_

PDB Entry: 1ees

PDB Description: solution structure of cdc42hs complexed with a peptide derived from p- 21 activated kinase, nmr, 20 structures

SCOP Domain Sequences for d1eesb_:

Sequence; same for both SEQRES and ATOM records:

>d1eesb_ j.65.1.1 (B:) Peptide derived from p-21 activated kinase {Mouse (Mus musculus)}
gskerpeislpsdfehtihvgfdavtgeftgipeqwarllqtsnit

Timeline for d1eesb_:

• d1eesb_ first appeared (with stable ids) in SCOP 1.55
  
• d1eesb_ appears in SCOP 1.69
  
• d1eesb_ appears in SCOP 1.73
  
• d1eesb_ appears in the current release, SCOPe 2.08