SCOP 1.55: Domain d1fqjc_: 1fqj C:

Lineage for d1fqjc_ (1fqj C:)

1. Root: SCOP 1.55
2. Class j: Peptides [58231] (77 folds)
3. Fold j.51: cAMP and cGMP phosphodiesterase (PDE) fragments [58650] (1 superfamily)
4. Superfamily j.51.1: cAMP and cGMP phosphodiesterase (PDE) fragments [58651] (1 family)
5. Family j.51.1.1: cAMP and cGMP phosphodiesterase (PDE) fragments [58652] (2 proteins)
6. Protein cGMP-PDE gamma [58655] (1 species)
7. Species Cow (Bos taurus) [TaxId:9913] [58656] (1 PDB entry)
8. Domain d1fqjc_: 1fqj C: [46332]
   Other proteins in same PDB: d1fqja1, d1fqja2, d1fqjb_, d1fqjd1, d1fqjd2, d1fqje_

Details for d1fqjc_

PDB Entry: 1fqj, 2.02 Å

PDB Description: crystal structure of the heterotrimeric complex of the rgs domain of rgs9, the gamma subunit of phosphodiesterase and the gt/i1 chimera alpha subunit [(rgs9)-(pdegamma)-(gt/i1alpha)-(gdp)-(alf4-)-(mg2+)]

SCOP Domain Sequences for d1fqjc_:

Sequence; same for both SEQRES and ATOM records:

>d1fqjc_ j.51.1.1 (C:) cGMP-PDE gamma {Cow (Bos taurus)}
fgddipgmeglgtditvicpweafnhlelhelaqygii

SCOP Domain Coordinates for d1fqjc_ are not available.

Timeline for d1fqjc_:

• d1fqjc_ appears in SCOP 1.57
  
• d1fqjc_ appears in the current release, SCOPe 2.08