Lineage for d1mof__ (1mof -)

  1. Root: SCOP 1.63
  2. 274027Class j: Peptides [58231] (101 folds)
  3. 274868Fold j.46: MoMLV p15 fragment (residues 409-426) [58624] (1 superfamily)
  4. 274869Superfamily j.46.1: MoMLV p15 fragment (residues 409-426) [58625] (1 family) (S)
  5. 274870Family j.46.1.1: MoMLV p15 fragment (residues 409-426) [58626] (1 protein)
  6. 274871Protein MoMLV p15 fragment (residues 409-426) [58627] (1 species)
  7. 274872Species Molomey murine leukaemia virus, MoMLV [58628] (1 PDB entry)
  8. 274873Domain d1mof__: 1mof - [46324]

Details for d1mof__

PDB Entry: 1mof (more details), 1.7 Å

PDB Description: coat protein

SCOP Domain Sequences for d1mof__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mof__ j.46.1.1 (-) MoMLV p15 fragment (residues 409-426) {Molomey murine leukaemia virus, MoMLV}
dlreveksisnleksltslsevvlqnrrgldllflkegglcaalkeecafyad

SCOP Domain Coordinates for d1mof__:

Click to download the PDB-style file with coordinates for d1mof__.
(The format of our PDB-style files is described here.)

Timeline for d1mof__: