Lineage for d1mofa_ (1mof A:)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2592473Superfamily h.3.2: Virus ectodomain [58069] (2 families) (S)
  5. 2592474Family h.3.2.1: Virus ectodomain [58070] (9 proteins)
  6. 2592511Protein MoMLV p15 core fragment [58627] (1 species)
  7. 2592512Species Moloney murine leukemia virus, MoMLV [TaxId:11801] [58628] (1 PDB entry)
  8. 2592513Domain d1mofa_: 1mof A: [46324]
    complexed with cl

Details for d1mofa_

PDB Entry: 1mof (more details), 1.7 Å

PDB Description: coat protein
PDB Compounds: (A:) moloney murine leukemia virus p15

SCOPe Domain Sequences for d1mofa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mofa_ h.3.2.1 (A:) MoMLV p15 core fragment {Moloney murine leukemia virus, MoMLV [TaxId: 11801]}
dlreveksisnleksltslsevvlqnrrgldllflkegglcaalkeecafyad

SCOPe Domain Coordinates for d1mofa_:

Click to download the PDB-style file with coordinates for d1mofa_.
(The format of our PDB-style files is described here.)

Timeline for d1mofa_: