Lineage for d1qfqb_ (1qfq B:)

  1. Root: SCOPe 2.02
  2. 1251156Class j: Peptides [58231] (120 folds)
  3. 1251520Fold j.9: Arg-rich RNA binding peptides [58321] (7 superfamilies)
  4. 1251592Superfamily j.9.5: Box B RNA-binding N peptide [58339] (1 family) (S)
  5. 1251593Family j.9.5.1: Box B RNA-binding N peptide [58340] (1 protein)
  6. 1251594Protein Box B RNA-binding N peptide [58341] (4 species)
  7. 1251597Species Bacteriophage lambda [TaxId:10710] [58343] (1 PDB entry)
  8. 1251598Domain d1qfqb_: 1qfq B: [46131]
    protein/RNA complex

Details for d1qfqb_

PDB Entry: 1qfq (more details)

PDB Description: bacteriophage lambda n-protein-nutboxb-rna complex
PDB Compounds: (B:) 36-mer N-terminal peptide of the N protein

SCOPe Domain Sequences for d1qfqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qfqb_ j.9.5.1 (B:) Box B RNA-binding N peptide {Bacteriophage lambda [TaxId: 10710]}
daqtrrrerraekqaqwkaanpllvgvsakpvnrp

SCOPe Domain Coordinates for d1qfqb_:

Click to download the PDB-style file with coordinates for d1qfqb_.
(The format of our PDB-style files is described here.)

Timeline for d1qfqb_: