Lineage for d1dv4e_ (1dv4 E:)

  1. Root: SCOPe 2.02
  2. 1248417Class i: Low resolution protein structures [58117] (25 folds)
  3. 1248418Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1248419Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1249711Family i.1.1.3: Small subunit [58132] (1 protein)
  6. 1249712Protein 30S subunit [58133] (1 species)
  7. 1249713Species Thermus thermophilus [TaxId:274] [58134] (13 PDB entries)
  8. 1249741Domain d1dv4e_: 1dv4 E: [45875]
    complexed with wo2

Details for d1dv4e_

PDB Entry: 1dv4 (more details), 4.5 Å

PDB Description: partial structure of 16s rna of the small ribosomal subunit from thermus thermophilus
PDB Compounds: (E:) ribosomal protein s5

SCOPe Domain Sequences for d1dv4e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dv4e_ i.1.1.3 (E:) 30S subunit {Thermus thermophilus [TaxId: 274]}
inpnkleleervvavnrvakvvkggrrlrfsalvvvgdknghvgfgtgkaqevpeairka
iedakknlievpivgttiphevighfgageiilkpasegtgviaggparavlelagisdi
lsksigsntpinmvratfdglkqlk

SCOPe Domain Coordinates for d1dv4e_:

Click to download the PDB-style file with coordinates for d1dv4e_.
(The format of our PDB-style files is described here.)

Timeline for d1dv4e_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dv4g_