SCOP 1.55: Domain d1dv4e_: 1dv4 E:

Lineage for d1dv4e_ (1dv4 E:)

1. Root: SCOP 1.55
2. Class i: Low resolution protein structures [58117] (12 folds)
3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)
5. Family i.1.1.3: Small subunit [58132] (1 protein)
6. Protein 30S subunit [58133] (1 species)
7. Species Thermus thermophilus [TaxId:274] [58134] (4 PDB entries)
8. Domain d1dv4e_: 1dv4 E: [45875]

Details for d1dv4e_

PDB Entry: 1dv4, 4.5 Å

PDB Description: partial structure of 16s rna of the small ribosomal subunit from thermus thermophilus

SCOP Domain Sequences for d1dv4e_:

Sequence; same for both SEQRES and ATOM records:

>d1dv4e_ i.1.1.3 (E:) 30S subunit {Thermus thermophilus}
inpnkleleervvavnrvakvvkggrrlrfsalvvvgdknghvgfgtgkaqevpeairka
iedakknlievpivgttiphevighfgageiilkpasegtgviaggparavlelagisdi
lsksigsntpinmvratfdglkqlk

SCOP Domain Coordinates for d1dv4e_ are not available.

Timeline for d1dv4e_:

• d1dv4e_ appears in SCOP 1.57
  
• d1dv4e_ appears in the current release, SCOPe 2.08