Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.3: Small subunit [58132] (1 protein) |
Protein 30S subunit [58133] (1 species) |
Species Thermus thermophilus [TaxId:274] [58134] (13 PDB entries) |
Domain d1qd7i_: 1qd7 I: [45872] |
PDB Entry: 1qd7 (more details), 5.5 Å
SCOPe Domain Sequences for d1qd7i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qd7i_ i.1.1.3 (I:) 30S subunit {Thermus thermophilus [TaxId: 274]} qrkvyvgrvvsdkmdktitvlvetykkhplygkrvkyskkykahdehneakvgdivkime trplsatkrfrlveivekavragagagaa
Timeline for d1qd7i_: