Lineage for d1qd7c1 (1qd7 C:43-200)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3044140Family i.1.1.3: Small subunit [58132] (3 proteins)
  6. 3044218Protein Prokaryotic (30S subunit) [58133] (1 species)
  7. 3044219Species Thermus thermophilus [TaxId:274] [58134] (13 PDB entries)
  8. 3044247Domain d1qd7c1: 1qd7 C:43-200 [45866]
    Other proteins in same PDB: d1qd7c2

Details for d1qd7c1

PDB Entry: 1qd7 (more details), 5.5 Å

PDB Description: partial model for 30s ribosomal subunit
PDB Compounds: (C:) s4 ribosomal protein

SCOPe Domain Sequences for d1qd7c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qd7c1 i.1.1.3 (C:43-200) Prokaryotic (30S subunit) {Thermus thermophilus [TaxId: 274]}
klseyglqlqekqklrhmygvnerqfrktfeeagkmpgkhgenfmillesrldnlvyrlg
lartrrqarqlvthghilvdgsrvnipsyrvkpgqtiavreksrnlqvikealeannyip
dylsfdpekmegtytrlperselpaeinealivefysr

SCOPe Domain Coordinates for d1qd7c1:

Click to download the PDB-style file with coordinates for d1qd7c1.
(The format of our PDB-style files is described here.)

Timeline for d1qd7c1: