SCOPe 2.01: Domain d1fkag_: 1fka G:

Lineage for d1fkag_ (1fka G:)

1. Root: SCOPe 2.01

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.3: Small subunit [58132] (1 protein)

6. Protein 30S subunit [58133] (1 species)

7. Species Thermus thermophilus [TaxId:274] [58134] (13 PDB entries)

8. Domain d1fkag_: 1fka G: [45850]
   protein/RNA complex; complexed with wo2

Details for d1fkag_

PDB Entry: 1fka, 3.3 Å

PDB Description: structure of functionally activated small ribosomal subunit at 3.3 a resolution

PDB Compounds: (G:) 30S ribosomal protein S7

SCOPe Domain Sequences for d1fkag_:

Sequence, based on SEQRES records:

>d1fkag_ i.1.1.3 (G:) 30S subunit {Thermus thermophilus [TaxId: 274]}
rrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkvf
kqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavriah
elmdaaegkggavkkkedvermae

Sequence, based on observed residues (ATOM records):

>d1fkag_ i.1.1.3 (G:) 30S subunit {Thermus thermophilus [TaxId: 274]}
rrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkvf
kqavenvkprmevsprrqqslalrwlvqaanqrperraavriahelmdaaegkggavkkk
edvermae

Timeline for d1fkag_:

• d1fkag_ first appeared (with stable ids) in SCOP 1.55
  
• d1fkag_ appears in SCOP 1.75
  
• d1fkag_ appears in SCOPe 2.02
  
• d1fkag_ appears in the current release, SCOPe 2.08