Lineage for d1fkaf_ (1fka F:)

  1. Root: SCOPe 2.01
  2. 1069520Class i: Low resolution protein structures [58117] (25 folds)
  3. 1069521Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1069522Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1070814Family i.1.1.3: Small subunit [58132] (1 protein)
  6. 1070815Protein 30S subunit [58133] (1 species)
  7. 1070816Species Thermus thermophilus [TaxId:274] [58134] (13 PDB entries)
  8. 1070827Domain d1fkaf_: 1fka F: [45849]
    protein/RNA complex; complexed with wo2

Details for d1fkaf_

PDB Entry: 1fka (more details), 3.3 Å

PDB Description: structure of functionally activated small ribosomal subunit at 3.3 a resolution
PDB Compounds: (F:) 30S ribosomal protein S6

SCOPe Domain Sequences for d1fkaf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fkaf_ i.1.1.3 (F:) 30S subunit {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepf

SCOPe Domain Coordinates for d1fkaf_:

Click to download the PDB-style file with coordinates for d1fkaf_.
(The format of our PDB-style files is described here.)

Timeline for d1fkaf_: