Lineage for d1fkad_ (1fka D:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3044140Family i.1.1.3: Small subunit [58132] (3 proteins)
  6. 3044218Protein Prokaryotic (30S subunit) [58133] (1 species)
  7. 3044219Species Thermus thermophilus [TaxId:274] [58134] (13 PDB entries)
  8. 3044228Domain d1fkad_: 1fka D: [45847]
    protein/RNA complex; complexed with wo2

Details for d1fkad_

PDB Entry: 1fka (more details), 3.3 Å

PDB Description: structure of functionally activated small ribosomal subunit at 3.3 a resolution
PDB Compounds: (D:) 30S ribosomal protein S4

SCOPe Domain Sequences for d1fkad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fkad_ i.1.1.3 (D:) Prokaryotic (30S subunit) {Thermus thermophilus [TaxId: 274]}
rrpsdyavrlrekqklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrl
gfavsrrqarqlvrhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgr
kvgpwlsldvegmkgkflrlpdredlalpvneqlviefysr

SCOPe Domain Coordinates for d1fkad_:

Click to download the PDB-style file with coordinates for d1fkad_.
(The format of our PDB-style files is described here.)

Timeline for d1fkad_: