![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
![]() | Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
![]() | Family i.1.1.3: Small subunit [58132] (3 proteins) |
![]() | Protein Prokaryotic (30S subunit) [58133] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [58134] (13 PDB entries) |
![]() | Domain d1fkad_: 1fka D: [45847] protein/RNA complex; complexed with wo2 |
PDB Entry: 1fka (more details), 3.3 Å
SCOPe Domain Sequences for d1fkad_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fkad_ i.1.1.3 (D:) Prokaryotic (30S subunit) {Thermus thermophilus [TaxId: 274]} rrpsdyavrlrekqklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrl gfavsrrqarqlvrhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgr kvgpwlsldvegmkgkflrlpdredlalpvneqlviefysr
Timeline for d1fkad_: