Lineage for d487dl_ (487d L:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3043573Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 3043708Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 3043847Species Escherichia coli [TaxId:562] [58127] (1 PDB entry)
  8. 3043852Domain d487dl_: 487d L: [45839]
    complexed with fmt, nh2

Details for d487dl_

PDB Entry: 487d (more details), 7.5 Å

PDB Description: seven ribosomal proteins fitted to a cryo-electron microscopic map of the large 50s subunit at 7.5 angstroms resolution
PDB Compounds: (L:) protein (50s l11 ribosomal protein)

SCOPe Domain Sequences for d487dl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d487dl_ i.1.1.2 (L:) Prokaryotic (50S subunit) {Escherichia coli [TaxId: 562]}
qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
fiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamki
iegtaksmgievv

SCOPe Domain Coordinates for d487dl_:

Click to download the PDB-style file with coordinates for d487dl_.
(The format of our PDB-style files is described here.)

Timeline for d487dl_: