Lineage for d487dk_ (487d K:)

  1. Root: SCOP 1.57
  2. Class i: Low resolution protein structures [58117] (15 folds)
  3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. Protein 50S subunit [58125] (2 species)
  7. Species Escherichia coli [TaxId:562] [58127] (1 PDB entry)
  8. Domain d487dk_: 487d K: [45838]

Details for d487dk_

PDB Entry: 487d (more details), 7.5 Å

PDB Description: seven ribosomal proteins fitted to a cryo-electron microscopic map of the large 50s subunit at 7.5 angstroms resolution

SCOP Domain Sequences for d487dk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d487dk_ i.1.1.2 (K:) 50S subunit {Escherichia coli}
mkviflkdvkgkgkkgeiknvadgyannflfkqglaieatpanlkaleaqkqkeqrqaae
elanakklkeqlekltvtipakageggrlfgsitskqiaeslqaqhglkldkrkielada
iralgytnvpvklhpevtatlkvhvteqk

SCOP Domain Coordinates for d487dk_ are not available.

Timeline for d487dk_:

View in 3D
Domains from other chains:
(mouse over for more information)
d487dh_, d487di_, d487dj_, d487dl_, d487dm_, d487dn_