Lineage for d487di_ (487d I:)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 896323Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 896324Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 897176Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 897177Protein 50S subunit [58125] (6 species)
  7. 897603Species Escherichia coli [TaxId:562] [58127] (1 PDB entry)
  8. 897605Domain d487di_: 487d I: [45836]

Details for d487di_

PDB Entry: 487d (more details), 7.5 Å

PDB Description: seven ribosomal proteins fitted to a cryo-electron microscopic map of the large 50s subunit at 7.5 angstroms resolution
PDB Compounds: (I:) protein (50s l2 ribosomal protein)

SCOP Domain Sequences for d487di_:

Sequence; same for both SEQRES and ATOM records: (download)

>d487di_ i.1.1.2 (I:) 50S subunit {Escherichia coli [TaxId: 562]}
qyriidfkrdkdgipgrvatieydpnrsanialinyadgekryiiapknlkvgmeimsgp
dadikignalplenipvgtlvhnielkpgrggqlvraagtsaqvlgkegkyvivrlasge
vrmilgkcratvgev

SCOP Domain Coordinates for d487di_:

Click to download the PDB-style file with coordinates for d487di_.
(The format of our PDB-style files is described here.)

Timeline for d487di_: