SCOPe 2.02: Domain d1c04a_: 1c04 A:

Lineage for d1c04a_ (1c04 A:)

1. Root: SCOPe 2.02

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.2: Large subunit [58124] (1 protein)

6. Protein 50S subunit [58125] (6 species)

7. Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)

8. Domain d1c04a_: 1c04 A: [45827]

Details for d1c04a_

PDB Entry: 1c04, 5 Å

PDB Description: identification of known protein and rna structures in a 5 a map of the large ribosomal subunit from haloarcula marismortui

PDB Compounds: (A:) ribosomal protein l2

SCOPe Domain Sequences for d1c04a_:

Sequence; same for both SEQRES and ATOM records:

>d1c04a_ i.1.1.2 (A:) 50S subunit {Haloarcula marismortui [TaxId: 2238]}
qyriidfkrdkdgipgrvatieydpnrsanialinyadgekryiiapknlkvgmeimsgp
dadikignalplenipvgtlvhnielkpgrggqlvraagtsaqvlgkegkyvivrlasge
vrmilgkcratvgev

Timeline for d1c04a_:

• d1c04a_ first appeared (with stable ids) in SCOP 1.55
  
• d1c04a_ appears in SCOPe 2.01
  
• d1c04a_ appears in SCOPe 2.03
  
• d1c04a_ appears in the current release, SCOPe 2.08