Lineage for d1eg0g_ (1eg0 G:)

  1. Root: SCOPe 2.01
  2. 1069520Class i: Low resolution protein structures [58117] (25 folds)
  3. 1069521Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1069522Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1069523Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1069524Protein 70S ribosome functional complex [58121] (9 species)
  7. 1069596Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 1069673Domain d1eg0g_: 1eg0 G: [45813]

Details for d1eg0g_

PDB Entry: 1eg0 (more details), 11.5 Å

PDB Description: fitting of components with known structure into an 11.5 a cryo-em map of the e.coli 70s ribosome
PDB Compounds: (G:) protein (s17 ribosomal protein)

SCOPe Domain Sequences for d1eg0g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eg0g_ i.1.1.1 (G:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
qrkvyvgrvvsdkmdktitvlvetykkhplygkrvkyskkykahdehneakvgdivkime
trplsatkrfrlveivekavragagagaa

SCOPe Domain Coordinates for d1eg0g_:

Click to download the PDB-style file with coordinates for d1eg0g_.
(The format of our PDB-style files is described here.)

Timeline for d1eg0g_: