SCOP 1.55: Domain d1eg0e_: 1eg0 E:

Lineage for d1eg0e_ (1eg0 E:)

1. Root: SCOP 1.55
2. Class i: Low resolution protein structures [58117] (12 folds)
3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)
5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)
6. Protein 70S ribosome functional complex [58121] (2 species)
7. Species Escherichia coli [TaxId:562] [58123] (2 PDB entries)
8. Domain d1eg0e_: 1eg0 E: [45811]

Details for d1eg0e_

PDB Entry: 1eg0

PDB Description: fitting of components with known structure into an 11.5 a cryo-em map of the e.coli 70s ribosome

SCOP Domain Sequences for d1eg0e_:

Sequence; same for both SEQRES and ATOM records:

>d1eg0e_ i.1.1.1 (E:) 70S ribosome functional complex {Escherichia coli}
tdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylrvy
lkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvltdr
earklgvggelicevw

SCOP Domain Coordinates for d1eg0e_ are not available.

Timeline for d1eg0e_:

• d1eg0e_ appears in SCOP 1.57
  
• d1eg0e_ appears in the current release, SCOPe 2.08