Lineage for d1eg0d_ (1eg0 D:)

  1. Root: SCOP 1.61
  2. 206238Class i: Low resolution protein structures [58117] (17 folds)
  3. 206239Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 206240Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 206241Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 206242Protein 70S ribosome functional complex [58121] (2 species)
  7. 206243Species Escherichia coli [TaxId:562] [58123] (7 PDB entries)
  8. 206247Domain d1eg0d_: 1eg0 D: [45810]

Details for d1eg0d_

PDB Entry: 1eg0 (more details)

PDB Description: fitting of components with known structure into an 11.5 a cryo-em map of the e.coli 70s ribosome

SCOP Domain Sequences for d1eg0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eg0d_ i.1.1.1 (D:) 70S ribosome functional complex {Escherichia coli}
lqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkvfkqavenvkp
rmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavriahelmdaaegk
ggavkkkedvermae

SCOP Domain Coordinates for d1eg0d_:

Click to download the PDB-style file with coordinates for d1eg0d_.
(The format of our PDB-style files is described here.)

Timeline for d1eg0d_: