Lineage for d1eg0c_ (1eg0 C:)

  1. Root: SCOP 1.55
  2. Class i: Low resolution protein structures [58117] (12 folds)
  3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. Protein 70S ribosome functional complex [58121] (2 species)
  7. Species Escherichia coli [TaxId:562] [58123] (2 PDB entries)
  8. Domain d1eg0c_: 1eg0 C: [45809]

Details for d1eg0c_

PDB Entry: 1eg0 (more details)

PDB Description: fitting of components with known structure into an 11.5 a cryo-em map of the e.coli 70s ribosome

SCOP Domain Sequences for d1eg0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eg0c_ i.1.1.1 (C:) 70S ribosome functional complex {Escherichia coli}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepf

SCOP Domain Coordinates for d1eg0c_ are not available.

Timeline for d1eg0c_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1eg0a_, d1eg0b_, d1eg0d_, d1eg0e_, d1eg0f_, d1eg0g_, d1eg0h_, d1eg0i_, d1eg0j_, d1eg0k_, d1eg0l_, d1eg0m_, d1eg0n_, d1eg0o_