SCOPe 2.06: Domain d1eg0a1: 1eg0 A:2-159

Lineage for d1eg0a1 (1eg0 A:2-159)

1. Root: SCOPe 2.06

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (3 proteins)

6. Protein 70S ribosome functional complex [58121] (4 species)

7. Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)

8. Domain d1eg0a1: 1eg0 A:2-159 [45807]
   Other proteins in same PDB: d1eg0a2

Details for d1eg0a1

PDB Entry: 1eg0, 11.5 Å

PDB Description: fitting of components with known structure into an 11.5 a cryo-em map of the e.coli 70s ribosome

PDB Compounds: (A:) protein (s4 ribosomal protein)

SCOPe Domain Sequences for d1eg0a1:

Sequence; same for both SEQRES and ATOM records:

>d1eg0a1 i.1.1.1 (A:2-159) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
klseyglqlqekqklrhmygvnerqfrktfeeagkmpgkhgenfmillesrldnlvyrlg
lartrrqarqlvthghilvdgsrvnipsyrvkpgqtiavreksrnlqvikealeannyip
dylsfdpekmegtytrlperselpaeinealivefysr

Timeline for d1eg0a1:

• d1eg0a1 first appeared (with stable ids) in SCOP 1.55, called d1eg0a_
  
• d1eg0a1 was called d1eg0a_ in SCOPe 2.05
  
• d1eg0a1 appears in SCOPe 2.07
  
• d1eg0a1 appears in the current release, SCOPe 2.08