SCOP 1.57: Domain d1eg0a_: 1eg0 A:

Lineage for d1eg0a_ (1eg0 A:)

1. Root: SCOP 1.57
2. Class i: Low resolution protein structures [58117] (15 folds)
3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)
5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)
6. Protein 70S ribosome functional complex [58121] (2 species)
7. Species Escherichia coli [TaxId:562] [58123] (5 PDB entries)
8. Domain d1eg0a_: 1eg0 A: [45807]

Details for d1eg0a_

PDB Entry: 1eg0

PDB Description: fitting of components with known structure into an 11.5 a cryo-em map of the e.coli 70s ribosome

SCOP Domain Sequences for d1eg0a_:

Sequence; same for both SEQRES and ATOM records:

>d1eg0a_ i.1.1.1 (A:) 70S ribosome functional complex {Escherichia coli}
mklseyglqlqekqklrhmygvnerqfrktfeeagkmpgkhgenfmillesrldnlvyrl
glartrrqarqlvthghilvdgsrvnipsyrvkpgqtiavreksrnlqvikealeannyi
pdylsfdpekmegtytrlperselpaeinealivefysr

SCOP Domain Coordinates for d1eg0a_ are not available.

Timeline for d1eg0a_:

• d1eg0a_ first appeared (with stable ids) in SCOP 1.55
  
• d1eg0a_ appears in SCOP 1.59
  
• d1eg0a_ appears in the current release, SCOPe 2.08, called d1eg0a1