Lineage for d1f31a4 (1f31 A:534-861)

  1. Root: SCOP 1.55
  2. Class h: Coiled coil proteins [57942] (5 folds)
  3. Fold h.4: Antiparallel coiled-coil [58086] (6 superfamilies)
  4. 42439Superfamily h.4.2: Clostridium neurotoxins, "coiled-coil" domain [58091] (1 family) (S)
  5. 42440Family h.4.2.1: Clostridium neurotoxins, "coiled-coil" domain [58092] (1 protein)
  6. 42441Protein Botulinum neurotoxin [58093] (2 species)
  7. 42444Species Clostridium botulinum, serotype B [TaxId:1491] [58095] (2 PDB entries)
  8. 42446Domain d1f31a4: 1f31 A:534-861 [45786]
    Other proteins in same PDB: d1f31a1, d1f31a2, d1f31a3

Details for d1f31a4

PDB Entry: 1f31 (more details), 2.6 Å

PDB Description: crystal structure of clostridium botulinum neurotoxin b complexed with a trisaccharide
PDB Compounds: (A:)

SCOP Domain Sequences for d1f31a4:

Sequence, based on SEQRES records: (download)

>d1f31a4 h.4.2.1 (A:534-861) Botulinum neurotoxin {Clostridium botulinum, serotype B}
ntifqylysqtfpldirdisltssfddallfsnkvysffsmdyiktankvveaglfagwv
kqivndfvieanksntmdkiadislivpyiglalnvgnetakgnfenafeiagasillef
ipellipvvgafllesyidnknkiiktidnaltkrnekwsdmyglivaqwlstvntqfyt
ikegmykalnyqaqaleeiikyryniysekeksninidfndinsklneginqaidninnf
ingcsvsylmkkmiplaveklldfdntlkknllnyidenklyligsaeyekskvnkylkt
impfdlsiytndtiliemfnkynseiln

Sequence, based on observed residues (ATOM records): (download)

>d1f31a4 h.4.2.1 (A:534-861) Botulinum neurotoxin {Clostridium botulinum, serotype B}
ntifqylysqtfpldirdisltssfddallfsnkvysffsmdyiktankvveaglfagwv
kqivndfvieanksntmdkiadislivpyiglalnvgnetakgnfenafeiagasillef
ipellipvvgafllesyidnknkiiktidnaltkrnekwsdmyglivaqwlstvntqfyt
ikegmykalnyqaqaleeiikyryniysekeksninidfndinsklneginqaidninnf
ingcsvsylmkkmiplaveklldfdntlkknllnyidenkigsaeyekskvnkylktimp
fdlsiytndtiliemfnkynseiln

SCOP Domain Coordinates for d1f31a4:

Click to download the PDB-style file with coordinates for d1f31a4.
(The format of our PDB-style files is described here.)

Timeline for d1f31a4: