Lineage for d3btaa4 (3bta A:547-871)

  1. Root: SCOP 1.55
  2. Class h: Coiled coil proteins [57942] (5 folds)
  3. Fold h.4: Antiparallel coiled-coil [58086] (6 superfamilies)
  4. 42439Superfamily h.4.2: Clostridium neurotoxins, "coiled-coil" domain [58091] (1 family) (S)
  5. 42440Family h.4.2.1: Clostridium neurotoxins, "coiled-coil" domain [58092] (1 protein)
  6. 42441Protein Botulinum neurotoxin [58093] (2 species)
  7. 42442Species Clostridium botulinum, serotype A [TaxId:1491] [58094] (1 PDB entry)
  8. 42443Domain d3btaa4: 3bta A:547-871 [45784]
    Other proteins in same PDB: d3btaa1, d3btaa2, d3btaa3

Details for d3btaa4

PDB Entry: 3bta (more details), 3.2 Å

PDB Description: crystal structure of botulinum neurotoxin serotype a

SCOP Domain Sequences for d3btaa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3btaa4 h.4.2.1 (A:547-871) Botulinum neurotoxin {Clostridium botulinum, serotype A}
ytmfhylraqefehgksrialtnsvneallnpsrvytffssdyvkkvnkateaamflgwv
eqlvydftdetsevsttdkiaditiiipyigpalnignmlykddfvgalifsgavillef
ipeiaipvlgtfalvsyiankvltvqtidnalskrnekwdevykyivtnwlakvntqidl
irkkmkealenqaeatkaiinyqynqyteeeknninfniddlssklnesinkamininkf
lnqcsvsylmnsmipygvkrledfdaslkdallkyiydnrgtligqvdrlkdkvnntlst
dipfqlskyvdnqrllstfteyikn

SCOP Domain Coordinates for d3btaa4:

Click to download the PDB-style file with coordinates for d3btaa4.
(The format of our PDB-style files is described here.)

Timeline for d3btaa4: