Lineage for d1svfd_ (1svf D:)

  1. Root: SCOP 1.65
  2. 344849Class h: Coiled coil proteins [57942] (6 folds)
  3. 345566Fold h.3: Stalk segment of viral fusion proteins [58063] (2 superfamilies)
    core: trimeric coiled coil
  4. 345630Superfamily h.3.2: Virus ectodomain [58069] (1 family) (S)
  5. 345631Family h.3.2.1: Virus ectodomain [58070] (6 proteins)
  6. 345660Protein Paramyxovirus sv5 fusion protein core [58078] (1 species)
    trimer of heterodimers
  7. 345661Species Simian virus 5, strain w3 [TaxId:11207] [58079] (1 PDB entry)
  8. 345665Domain d1svfd_: 1svf D: [45766]

Details for d1svfd_

PDB Entry: 1svf (more details), 1.4 Å

PDB Description: paramyxovirus sv5 fusion protein core

SCOP Domain Sequences for d1svfd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1svfd_ h.3.2.1 (D:) Paramyxovirus sv5 fusion protein core {Simian virus 5, strain w3}
sidpldisqnlaavnkslsdalqhlaqsdtylsai

SCOP Domain Coordinates for d1svfd_:

Click to download the PDB-style file with coordinates for d1svfd_.
(The format of our PDB-style files is described here.)

Timeline for d1svfd_: