SCOPe 2.07: Domain d1ebof1: 1ebo F:30-133

Lineage for d1ebof1 (1ebo F:30-133)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.2: Virus ectodomain [58069] (2 families)

5. Family h.3.2.1: Virus ectodomain [58070] (9 proteins)

6. Protein Core structure of Ebo gp2 [58076] (1 species)

7. Species Ebola virus [TaxId:205488] [58077] (2 PDB entries)

8. Domain d1ebof1: 1ebo F:30-133 [45762]
   Other proteins in same PDB: d1eboa2, d1ebob2, d1eboc2, d1ebod2, d1eboe2, d1ebof2
   chimeric, contains a fragment of gcn4 zipper at the N-terminus (res. 1-29)
   complexed with cl, zn

Details for d1ebof1

PDB Entry: 1ebo, 3 Å

PDB Description: crystal structure of the ebola virus membrane-fusion subunit, gp2, from the envelope glycoprotein ectodomain

PDB Compounds: (F:) ebola virus envelope protein chimera consisting of a fragment of gcn4 zipper cloned n-terminal to a fragment of gp2

SCOPe Domain Sequences for d1ebof1:

Sequence; same for both SEQRES and ATOM records:

>d1ebof1 h.3.2.1 (F:30-133) Core structure of Ebo gp2 {Ebola virus [TaxId: 205488]}
geadglieglrqlanettqalqlflrattelrtfsilnrkaidfllqrwggtchilgpdc
riephdwtknitdkidqiihdfvdkt

Timeline for d1ebof1:

• d1ebof1 first appeared (with stable ids) in SCOP 1.55, called d1ebof_
  
• d1ebof1 was called d1ebof_ in SCOPe 2.06
  
• d1ebof1 appears in the current release, SCOPe 2.08