Lineage for d2ezsa_ (2ezs A:)

  1. Root: SCOP 1.65
  2. 344849Class h: Coiled coil proteins [57942] (6 folds)
  3. 345566Fold h.3: Stalk segment of viral fusion proteins [58063] (2 superfamilies)
    core: trimeric coiled coil
  4. 345630Superfamily h.3.2: Virus ectodomain [58069] (1 family) (S)
  5. 345631Family h.3.2.1: Virus ectodomain [58070] (6 proteins)
  6. 345666Protein Retrovius gp41 protease-resistant core [58071] (3 species)
    coiled coil; biological unit: trimer
  7. 345690Species Simian immunodeficiency virus [58073] (10 PDB entries)
  8. 345710Domain d2ezsa_: 2ezs A: [45744]

Details for d2ezsa_

PDB Entry: 2ezs (more details)

PDB Description: solution nmr structure of ectodomain of siv gp41, models 31-40 of an ensemble of 40 simulated annealing structures

SCOP Domain Sequences for d2ezsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ezsa_ h.3.2.1 (A:) Retrovius gp41 protease-resistant core {Simian immunodeficiency virus}
aqsrtllagivqqqqqlldvvkrqqellrltvwgtknlqtrvtaiekylkdqaqlnawga
afrqvahttvpwpnasltpkwnnetwqewerkvdfleenitalleeaqiqqeknmyelqk
lns

SCOP Domain Coordinates for d2ezsa_:

Click to download the PDB-style file with coordinates for d2ezsa_.
(The format of our PDB-style files is described here.)

Timeline for d2ezsa_: