SCOP 1.65: Domain d1df4a_: 1df4 A:

Lineage for d1df4a_ (1df4 A:)

1. Root: SCOP 1.65

2. Class h: Coiled coil proteins [57942] (6 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (2 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.2: Virus ectodomain [58069] (1 family)

5. Family h.3.2.1: Virus ectodomain [58070] (6 proteins)

6. Protein Retrovius gp41 protease-resistant core [58071] (3 species)
   coiled coil; biological unit: trimer

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [58072] (16 PDB entries)

8. Domain d1df4a_: 1df4 A: [45719]

Details for d1df4a_

PDB Entry: 1df4, 1.45 Å

PDB Description: interactions between hiv-1 gp41 core and detergents and their implications for membrane fusion

SCOP Domain Sequences for d1df4a_:

Sequence, based on SEQRES records:

>d1df4a_ h.3.2.1 (A:) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1}
ivqqqnnllraieaqqhllqltvwgikqlqarsggrggwmewdreinnytslihsliees
qn

Sequence, based on observed residues (ATOM records):

>d1df4a_ h.3.2.1 (A:) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1}
ivqqqnnllraieaqqhllqltvwgikqlqaggwmewdreinnytslihslieesqn

Timeline for d1df4a_:

• d1df4a_ first appeared (with stable ids) in SCOP 1.55
  
• d1df4a_ appears in SCOP 1.63
  
• d1df4a_ appears in SCOP 1.67
  
• d1df4a_ appears in the current release, SCOPe 2.08