SCOPe 2.02: Domain d5hmgd_: 5hmg D:

Lineage for d5hmgd_ (5hmg D:)

1. Root: SCOPe 2.02

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)

6. Protein Influenza hemagglutinin (stalk) [58066] (2 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (38 PDB entries)

8. Domain d5hmgd_: 5hmg D: [45714]
   Other proteins in same PDB: d5hmga_, d5hmgc_, d5hmge_
   complexed with nag, sia

Details for d5hmgd_

PDB Entry: 5hmg, 3.2 Å

PDB Description: refinement of the influenza virus hemagglutinin by simulated annealing

PDB Compounds: (D:) hemagglutinin, ha1 chain

SCOPe Domain Sequences for d5hmgd_:

Sequence; same for both SEQRES and ATOM records:

>d5hmgd_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltgsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg

Timeline for d5hmgd_:

• d5hmgd_ first appeared (with stable ids) in SCOP 1.55
  
• d5hmgd_ appears in SCOPe 2.01
  
• d5hmgd_ appears in SCOPe 2.03
  
• d5hmgd_ appears in the current release, SCOPe 2.08