SCOPe 2.03: Domain d1hgfd_: 1hgf D:

Lineage for d1hgfd_ (1hgf D:)

1. Root: SCOPe 2.03

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)

6. Protein Influenza hemagglutinin (stalk) [58066] (2 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (45 PDB entries)

8. Domain d1hgfd_: 1hgf D: [45711]
   Other proteins in same PDB: d1hgfa_, d1hgfc_, d1hgfe_
   complexed with nag

Details for d1hgfd_

PDB Entry: 1hgf, 3 Å

PDB Description: binding of influenza virus hemagglutinin to analogs of its cell- surface receptor, sialic acid: analysis by proton nuclear magnetic resonance spectroscopy and x-ray crystallography

PDB Compounds: (D:) hemagglutinin, chain ha1

SCOPe Domain Sequences for d1hgfd_:

Sequence; same for both SEQRES and ATOM records:

>d1hgfd_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg

Timeline for d1hgfd_:

• d1hgfd_ first appeared (with stable ids) in SCOP 1.55
  
• d1hgfd_ appears in SCOPe 2.02
  
• d1hgfd_ appears in SCOPe 2.04
  
• d1hgfd_ appears in the current release, SCOPe 2.08