Class h: Coiled coil proteins [57942] (6 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (2 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein) |
Protein Influenza hemagglutinin (stalk) [58066] (2 species) trimer |
Species Influenza A virus, different strains [TaxId:11320] [58067] (35 PDB entries) |
Domain d3hmgd_: 3hmg D: [45705] Other proteins in same PDB: d3hmga_, d3hmgc_, d3hmge_ |
PDB Entry: 3hmg (more details), 2.9 Å
SCOP Domain Sequences for d3hmgd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hmgd_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains} glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg
Timeline for d3hmgd_: