Lineage for d1hggf_ (1hgg F:)

  1. Root: SCOP 1.67
  2. 431023Class h: Coiled coil proteins [57942] (6 folds)
  3. 431801Fold h.3: Stalk segment of viral fusion proteins [58063] (2 superfamilies)
    core: trimeric coiled coil
  4. 431802Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S)
  5. 431803Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
  6. 431804Protein Influenza hemagglutinin (stalk) [58066] (2 species)
    trimer
  7. 431805Species Influenza A virus, different strains [TaxId:11320] [58067] (35 PDB entries)
  8. 431890Domain d1hggf_: 1hgg F: [45700]
    Other proteins in same PDB: d1hgga_, d1hggc_, d1hgge_
    complexed with gal, glc, man, nag, nan

Details for d1hggf_

PDB Entry: 1hgg (more details), 2.9 Å

PDB Description: binding of influenza virus hemagglutinin to analogs of its cell- surface receptor, sialic acid: analysis by proton nuclear magnetic resonance spectroscopy and x-ray crystallography

SCOP Domain Sequences for d1hggf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hggf_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg

SCOP Domain Coordinates for d1hggf_:

Click to download the PDB-style file with coordinates for d1hggf_.
(The format of our PDB-style files is described here.)

Timeline for d1hggf_: