Lineage for d1hghb_ (1hgh B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3041028Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries)
  8. 3041223Domain d1hghb_: 1hgh B: [45694]
    Other proteins in same PDB: d1hgha_, d1hghc_, d1hghe_
    complexed with mna, nag

Details for d1hghb_

PDB Entry: 1hgh (more details), 2.7 Å

PDB Description: binding of influenza virus hemagglutinin to analogs of its cell- surface receptor, sialic acid: analysis by proton nuclear magnetic resonance spectroscopy and x-ray crystallography
PDB Compounds: (B:) hemagglutinin, chain ha1

SCOPe Domain Sequences for d1hghb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hghb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg

SCOPe Domain Coordinates for d1hghb_:

Click to download the PDB-style file with coordinates for d1hghb_.
(The format of our PDB-style files is described here.)

Timeline for d1hghb_: