Lineage for d1hgdd_ (1hgd D:)

  1. Root: SCOP 1.65
  2. 344849Class h: Coiled coil proteins [57942] (6 folds)
  3. 345566Fold h.3: Stalk segment of viral fusion proteins [58063] (2 superfamilies)
    core: trimeric coiled coil
  4. 345567Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S)
  5. 345568Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
  6. 345569Protein Influenza hemagglutinin (stalk) [58066] (2 species)
    trimer
  7. 345570Species Influenza A virus, different strains [TaxId:11320] [58067] (24 PDB entries)
  8. 345592Domain d1hgdd_: 1hgd D: [45692]
    Other proteins in same PDB: d1hgda_, d1hgdc_, d1hgde_

Details for d1hgdd_

PDB Entry: 1hgd (more details), 2.7 Å

PDB Description: binding of influenza virus hemagglutinin to analogs of its cell- surface receptor, sialic acid: analysis by proton nuclear magnetic resonance spectroscopy and x-ray crystallography

SCOP Domain Sequences for d1hgdd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hgdd_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg

SCOP Domain Coordinates for d1hgdd_:

Click to download the PDB-style file with coordinates for d1hgdd_.
(The format of our PDB-style files is described here.)

Timeline for d1hgdd_: