SCOPe 2.03: Domain d1eo8b_: 1eo8 B:

Lineage for d1eo8b_ (1eo8 B:)

1. Root: SCOPe 2.03

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)

6. Protein Influenza hemagglutinin (stalk) [58066] (2 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (45 PDB entries)

8. Domain d1eo8b_: 1eo8 B: [45690]
   Other proteins in same PDB: d1eo8a_, d1eo8h1, d1eo8h2, d1eo8l1, d1eo8l2
   complexed with nag

Details for d1eo8b_

PDB Entry: 1eo8, 2.8 Å

PDB Description: influenza virus hemagglutinin complexed with a neutralizing antibody

PDB Compounds: (B:) hemagglutinin (ha2 chain)

SCOPe Domain Sequences for d1eo8b_:

Sequence; same for both SEQRES and ATOM records:

>d1eo8b_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg

Timeline for d1eo8b_:

• d1eo8b_ first appeared (with stable ids) in SCOP 1.55
  
• d1eo8b_ appears in SCOPe 2.02
  
• d1eo8b_ appears in SCOPe 2.04
  
• d1eo8b_ appears in the current release, SCOPe 2.08