Class h: Coiled coil proteins [57942] (6 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (2 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein) |
Protein Influenza hemagglutinin (stalk) [58066] (2 species) trimer |
Species Influenza A virus, different strains [TaxId:11320] [58067] (35 PDB entries) |
Domain d1eo8b_: 1eo8 B: [45690] Other proteins in same PDB: d1eo8a_, d1eo8h1, d1eo8h2, d1eo8l1, d1eo8l2 complexed with man, nag |
PDB Entry: 1eo8 (more details), 2.8 Å
SCOP Domain Sequences for d1eo8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eo8b_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains} glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg
Timeline for d1eo8b_: