SCOP 1.55: Domain d1eo8b_: 1eo8 B:

Lineage for d1eo8b_ (1eo8 B:)

1. Root: SCOP 1.55
2. Class h: Coiled coil proteins [57942] (5 folds)
3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family)
5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
6. Protein Influenza hemagglutinin (stalk) [58066] (2 species)
7. Species Influenza A virus, different strains [TaxId:11320] [58067] (17 PDB entries)
8. Domain d1eo8b_: 1eo8 B: [45690]
   Other proteins in same PDB: d1eo8a_, d1eo8h1, d1eo8h2, d1eo8l1, d1eo8l2

Details for d1eo8b_

PDB Entry: 1eo8, 2.8 Å

PDB Description: influenza virus hemagglutinin complexed with a neutralizing antibody

SCOP Domain Sequences for d1eo8b_:

Sequence; same for both SEQRES and ATOM records:

>d1eo8b_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg

SCOP Domain Coordinates for d1eo8b_ are not available.

Timeline for d1eo8b_:

• d1eo8b_ appears in SCOP 1.57
  
• d1eo8b_ appears in the current release, SCOPe 2.08