Lineage for d1qfub_ (1qfu B:)

  1. Root: SCOP 1.57
  2. Class h: Coiled coil proteins [57942] (5 folds)
  3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
  4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S)
  5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
  6. Protein Influenza hemagglutinin (stalk) [58066] (2 species)
  7. Species Influenza A virus, different strains [TaxId:11320] [58067] (23 PDB entries)
  8. Domain d1qfub_: 1qfu B: [45689]
    Other proteins in same PDB: d1qfua_, d1qfuh1, d1qfuh2, d1qful1, d1qful2

Details for d1qfub_

PDB Entry: 1qfu (more details), 2.8 Å

PDB Description: influenza virus hemagglutinin complexed with a neutralizing antibody

SCOP Domain Sequences for d1qfub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qfub_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqik

SCOP Domain Coordinates for d1qfub_ are not available.

Timeline for d1qfub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qfua_, d1qfuh1, d1qfuh2, d1qful1, d1qful2