SCOP 1.65: Domain d1hgid_: 1hgi D:

Lineage for d1hgid_ (1hgi D:)

1. Root: SCOP 1.65

2. Class h: Coiled coil proteins [57942] (6 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (2 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)

6. Protein Influenza hemagglutinin (stalk) [58066] (2 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (24 PDB entries)

8. Domain d1hgid_: 1hgi D: [45684]
   Other proteins in same PDB: d1hgia_, d1hgic_, d1hgie_

Details for d1hgid_

PDB Entry: 1hgi, 2.7 Å

PDB Description: binding of influenza virus hemagglutinin to analogs of its cell- surface receptor, sialic acid: analysis by proton nuclear magnetic resonance spectroscopy and x-ray crystallography

SCOP Domain Sequences for d1hgid_:

Sequence; same for both SEQRES and ATOM records:

>d1hgid_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg

Timeline for d1hgid_:

• d1hgid_ first appeared (with stable ids) in SCOP 1.55
  
• d1hgid_ appears in SCOP 1.63
  
• d1hgid_ appears in SCOP 1.67
  
• d1hgid_ appears in the current release, SCOPe 2.08