SCOPe 2.02: Domain d1hgef_: 1hge F:

Lineage for d1hgef_ (1hge F:)

1. Root: SCOPe 2.02

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)

6. Protein Influenza hemagglutinin (stalk) [58066] (2 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (38 PDB entries)

8. Domain d1hgef_: 1hge F: [45682]
   Other proteins in same PDB: d1hgea_, d1hgec_, d1hgee_
   complexed with mna, nag

Details for d1hgef_

PDB Entry: 1hge, 2.6 Å

PDB Description: binding of influenza virus hemagglutinin to analogs of its cell- surface receptor, sialic acid: analysis by proton nuclear magnetic resonance spectroscopy and x-ray crystallography

PDB Compounds: (F:) hemagglutinin, (g135r), ha1 chain

SCOPe Domain Sequences for d1hgef_:

Sequence; same for both SEQRES and ATOM records:

>d1hgef_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg

Timeline for d1hgef_:

• d1hgef_ first appeared (with stable ids) in SCOP 1.55
  
• d1hgef_ appears in SCOPe 2.01
  
• d1hgef_ appears in SCOPe 2.03
  
• d1hgef_ appears in the current release, SCOPe 2.08