SCOPe 2.03: Domain d1qu1c_: 1qu1 C:

Lineage for d1qu1c_ (1qu1 C:)

1. Root: SCOPe 2.03

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)

6. Protein Influenza hemagglutinin (stalk) [58066] (2 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (45 PDB entries)

8. Domain d1qu1c_: 1qu1 C: [45672]

Details for d1qu1c_

PDB Entry: 1qu1, 1.9 Å

PDB Description: crystal structure of eha2 (23-185)

PDB Compounds: (C:) protein (influenza recombinant ha2 chain)

SCOPe Domain Sequences for d1qu1c_:

Sequence; same for both SEQRES and ATOM records:

>d1qu1c_ h.3.1.1 (C:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
adlkstqaaidqingklnrviektnekfhqiekefsevegriqdlekyvedtkidlwsyn
aellvalenqhtidltdsemnklfektrrqlrenaeemgngsfkiyhkcdnaciesirng
tydhdvyrdealnnrfqikgvelksgykdw

Timeline for d1qu1c_:

• d1qu1c_ first appeared (with stable ids) in SCOP 1.55
  
• d1qu1c_ appears in SCOPe 2.02
  
• d1qu1c_ appears in SCOPe 2.04
  
• d1qu1c_ appears in the current release, SCOPe 2.08