Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein) |
Protein Influenza hemagglutinin (stalk) [58066] (2 species) trimer |
Species Influenza A virus, different strains [TaxId:11320] [58067] (38 PDB entries) |
Domain d1qu1c_: 1qu1 C: [45672] |
PDB Entry: 1qu1 (more details), 1.9 Å
SCOPe Domain Sequences for d1qu1c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qu1c_ h.3.1.1 (C:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]} adlkstqaaidqingklnrviektnekfhqiekefsevegriqdlekyvedtkidlwsyn aellvalenqhtidltdsemnklfektrrqlrenaeemgngsfkiyhkcdnaciesirng tydhdvyrdealnnrfqikgvelksgykdw
Timeline for d1qu1c_: