Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.17: Fibritin [58046] (1 family) |
Family h.1.17.1: Fibritin [58047] (1 protein) |
Protein Fibritin [58048] (2 species) biological unit: trimer; fragmented coiled coil capped with beta-hairpin triplet |
Species Bacteriophage T4 [TaxId:10665] [58049] (7 PDB entries) Uniprot P10104 |
Domain d1avyc_: 1avy C: [45658] deletion mutant M mutant |
PDB Entry: 1avy (more details), 1.85 Å
SCOPe Domain Sequences for d1avyc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1avyc_ h.1.17.1 (C:) Fibritin {Bacteriophage T4 [TaxId: 10665]} ltnkikaietdiasvrqevntakgnisslqgdvqalqeagyipeaprdgqayvrkdgewv llstflsp
Timeline for d1avyc_: