Lineage for d1avyc_ (1avy C:)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2590058Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2591146Superfamily h.1.17: Fibritin [58046] (1 family) (S)
  5. 2591147Family h.1.17.1: Fibritin [58047] (1 protein)
  6. 2591148Protein Fibritin [58048] (2 species)
    biological unit: trimer; fragmented coiled coil capped with beta-hairpin triplet
  7. 2591149Species Bacteriophage T4 [TaxId:10665] [58049] (7 PDB entries)
    Uniprot P10104
  8. 2591166Domain d1avyc_: 1avy C: [45658]
    deletion mutant M
    mutant

Details for d1avyc_

PDB Entry: 1avy (more details), 1.85 Å

PDB Description: fibritin deletion mutant m (bacteriophage t4)
PDB Compounds: (C:) fibritin

SCOPe Domain Sequences for d1avyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1avyc_ h.1.17.1 (C:) Fibritin {Bacteriophage T4 [TaxId: 10665]}
ltnkikaietdiasvrqevntakgnisslqgdvqalqeagyipeaprdgqayvrkdgewv
llstflsp

SCOPe Domain Coordinates for d1avyc_:

Click to download the PDB-style file with coordinates for d1avyc_.
(The format of our PDB-style files is described here.)

Timeline for d1avyc_: