Lineage for d1avya_ (1avy A:)

  1. Root: SCOP 1.55
  2. Class h: Coiled coil proteins [57942] (5 folds)
  3. Fold h.1: Parallel coiled-coil [57943] (19 superfamilies)
  4. Superfamily h.1.17: Fibritin [58046] (1 family) (S)
  5. Family h.1.17.1: Fibritin [58047] (1 protein)
  6. Protein Fibritin [58048] (1 species)
  7. Species Bacteriophage T4 [TaxId:10665] [58049] (2 PDB entries)
  8. Domain d1avya_: 1avy A: [45656]

Details for d1avya_

PDB Entry: 1avy (more details), 1.85 Å

PDB Description: fibritin deletion mutant m (bacteriophage t4)

SCOP Domain Sequences for d1avya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1avya_ h.1.17.1 (A:) Fibritin {Bacteriophage T4}
tnkikaietdiasvrqevntakgnisslqgdvqalqeagyipeaprdgqayvrkdgewvl
lstflspa

SCOP Domain Coordinates for d1avya_ are not available.

Timeline for d1avya_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1avyb_, d1avyc_